SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0DAS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K0DAS3
Domain Number 1 Region: 11-76
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000000149
Family Poly(A) polymerase, PAP, N-terminal domain 0.051
Further Details:      
 
Domain Number 2 Region: 89-146
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0000000029
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K0DAS3
Sequence length 191
Comment (tr|A0A0K0DAS3|A0A0K0DAS3_ANGCA) Uncharacterized protein {ECO:0000313|WBParaSite:ACAC_0000742301-mRNA-1} KW=Complete proteome; Reference proteome OX=6313 OS=Angiostrongylus cantonensis (Rat lungworm). GN= OC=Strongylida; Metastrongyloidea; Angiostrongylidae; Angiostrongylus.
Sequence
LRSALSTTEKVVVPIGSSVNGLGSKNSDLDIVVVVKQHRVRAMKFIKVPILKFRSCDGVN
VDLQFNNIPSIRSSLFVRTCVEFSMIVPINIHWINSFFKAAQLKDSRHGLFSSYHLNMLA
LHFLQATPSPLLPDMISSYPYLQPTVPWQNVAERLTTEPFIQAVFRTKYSLYSSEIFTVS
YLSVYYAVGHM
Download sequence
Identical sequences A0A0K0DAS3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]