SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0DH12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K0DH12
Domain Number 1 Region: 1-210
Classification Level Classification E-value
Superfamily Bactericidal permeability-increasing protein, BPI 1.88e-32
Family Bactericidal permeability-increasing protein, BPI 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K0DH12
Sequence length 231
Comment (tr|A0A0K0DH12|A0A0K0DH12_ANGCA) Uncharacterized protein {ECO:0000313|WBParaSite:ACAC_0001042401-mRNA-1} KW=Complete proteome; Reference proteome OX=6313 OS=Angiostrongylus cantonensis (Rat lungworm). GN= OC=Strongylida; Metastrongyloidea; Angiostrongylidae; Angiostrongylus.
Sequence
MAEFFATDYIANSMLYHAYRQHLMDVVVGPESSPQLKGLLSTSCSSTFCIGEYLGTLGEQ
YPDREVEIVFTARKAPLIVFIEDRARFRLHGRMNMYVRPNNETQVKEMIIRSDTTMTANV
NMWLNGTRIIGNATIENLDFRLLETKASIKDVDQASFGDLGLFGAEFLEKLLTEILQLGI
TMPTMLGVQLKSPRLTFHERYLRVQTYFKLDERFTSELFQKAVRQTLNHVG
Download sequence
Identical sequences A0A0K0DH12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]