SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0EB10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K0EB10
Domain Number 1 Region: 482-540
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000000275
Family ATI-like 0.041
Further Details:      
 
Domain Number 2 Region: 177-234
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000288
Family ATI-like 0.028
Further Details:      
 
Domain Number 3 Region: 26-86
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000353
Family ATI-like 0.057
Further Details:      
 
Domain Number 4 Region: 628-687
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000876
Family ATI-like 0.03
Further Details:      
 
Domain Number 5 Region: 558-615
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000249
Family ATI-like 0.013
Further Details:      
 
Domain Number 6 Region: 420-474
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000746
Family ATI-like 0.036
Further Details:      
 
Domain Number 7 Region: 329-387
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000759
Family ATI-like 0.019
Further Details:      
 
Domain Number 8 Region: 268-321
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000275
Family ATI-like 0.022
Further Details:      
 
Domain Number 9 Region: 115-169
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000576
Family ATI-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K0EB10
Sequence length 720
Comment (tr|A0A0K0EB10|A0A0K0EB10_STRER) Uncharacterized protein {ECO:0000313|WBParaSite:SSTP_0000668100.1} KW=Complete proteome; Reference proteome OX=6248 OS=Strongyloides stercoralis (Threadworm). GN= OC=Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides.
Sequence
MQIKLVFLISILFLTYISYNEARKRPKQCRKHMIYKMCTKTCPKTCDKNENKGKRCFLDC
KHPGCECKRGYVLAKKNKCVRKSKCHKYRTTTKKPTTTMKMIETTTTASSQQCLGNNTEY
TDCLSSCPLKCSDITKVVPCTANCNGVGCQCKQGYYLNKKNECISKTKCIKDPEEEVCPP
NSEYSFCKSLFTRTCSYRFLRPRRFSLRCAGEGCQCKHGYYYKNGKCITAEECDATTTST
SSTRSITTTTTKMIETTTTASSQQCLKNNTVYTECLSACPLKCSDITKSAPCTANCNGVG
CQCKPGYYLNKNNECISFFECINDPKEEVCPQNSKYTFCRSFCFKSCSNRNLDEIGCNIP
KCAGAGCQCEKGYYYNNGKCLTLEECDKLPTTTEKPTMKPTTTTKMIKTTTTASSQQCLG
NNTEYTDCLSSCPLKCSDITKSDKCAVYCNGPGCQCKEGYFLNKKNECVSITECVKDPEE
EVCPPNMVYKFCRSYCPSTCSDRFLWFRPCKLMCKPPGCQCKSGYYLNKEGKCVTSSECD
ATTTTTLTTTITTTKPTPVCPTNMVYTLCKSACQPKCWEKERNWCIFMCAGVGCECRKPF
ALNHKGECVERHQCPVYKSTTTRRPTTTPVCPANMVYTKCKSSCPPKCTDKEGEPKICTF
NCDGEGCECRAPFALDSEGNCIKKSECTISTTTAKPSRRRFLLYYTKKTFQSLLSYIYQK
Download sequence
Identical sequences A0A0K0EB10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]