SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0EVJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K0EVJ4
Domain Number 1 Region: 7-48
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000732
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0056
Further Details:      
 
Domain Number 2 Region: 154-201
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000117
Family Motor proteins 0.016
Further Details:      
 
Domain Number 3 Region: 63-201
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000207
Family Motor proteins 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K0EVJ4
Sequence length 224
Comment (tr|A0A0K0EVJ4|A0A0K0EVJ4_9BILA) Uncharacterized protein {ECO:0000313|WBParaSite:SVE_0054400.1} KW=Complete proteome; Reference proteome OX=75913 OS=Strongyloides venezuelensis. GN= OC=Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides.
Sequence
MSEQMSEKYKIPEALRPLLEALARETIRAQPTDVILFGKLFFDILSLHQKDCDKSVISDN
ISYDMFRMDLQQHYKNMTMKENIMRSVSPEDIAATKIQAVFRGHQVRMHPEKYGIDNELV
RRRSSDKFPTLDFKKDQKRHSIGGYSLEHSQTPEDRAATKIQAEFRGYLARKNVQAMREQ
NDNAATKIQAHVRGFLTRKRLGKEGLISPSRSHSSLQSHKSEEN
Download sequence
Identical sequences A0A0K0EVJ4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]