SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0FA06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K0FA06
Domain Number 1 Region: 202-260
Classification Level Classification E-value
Superfamily BPTI-like 8.66e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0028
Further Details:      
 
Domain Number 2 Region: 143-185
Classification Level Classification E-value
Superfamily Elafin-like 0.000000012
Family Elafin-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K0FA06
Sequence length 317
Comment (tr|A0A0K0FA06|A0A0K0FA06_9BILA) Uncharacterized protein {ECO:0000313|WBParaSite:SVE_0565800.1} KW=Complete proteome; Reference proteome OX=75913 OS=Strongyloides venezuelensis. GN= OC=Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides.
Sequence
MANISFYTIYLFLILIYFIKFNYGRTNIDIVLRKDFCEKLNKINKAHRHPSCNEYFGNSK
KTRFVKRKKLTTLSVPIIKEDMSSENDILEPKELTHDEIYDCRNSDTILQCKTDFVNCPK
SGQICSNTDNTICCQNVIKSIPVSHINSKPGNCPTPLGIFIPQDATVGCWLDQNCPGIQK
CCLEPNPSSNTATRLCRDPINIPSHSVCNLPLSVGVCNAPTIRYYYDSVTGKCRNFQYSG
CGGNKNNFQTLASCQANCGSAGIMGNPECPMEANISLNCLFAHPDACKTDSDCMGRINTK
QSSCCMTKCGYRICHQY
Download sequence
Identical sequences A0A0K0FA06

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]