SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0FRD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K0FRD0
Domain Number 1 Region: 68-178
Classification Level Classification E-value
Superfamily Bactericidal permeability-increasing protein, BPI 0.0000628
Family Bactericidal permeability-increasing protein, BPI 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K0FRD0
Sequence length 226
Comment (tr|A0A0K0FRD0|A0A0K0FRD0_9BILA) Uncharacterized protein {ECO:0000313|WBParaSite:SVE_1245900.1} KW=Complete proteome; Reference proteome OX=75913 OS=Strongyloides venezuelensis. GN= OC=Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides.
Sequence
MNASDAINYLNKAIVCSAEFLKFWAVKFILFNVESILETKQWIEFVQKNSEFISEIDKNG
NVNRNTIPGKQIQFSSVGLSYVAGVAIDYINSAIAKVNIPDIEGEYQEKCQLIIKLKLRK
GLFITFVDASVGISPLNANFGVFVIKFHRSLLDDIIELFRKEIEKHFKEKIEIICQVIER
VESDQGVLYIMKDQNDPKIPKPNNVIHPYNTNKYLCIIPNRYSRWF
Download sequence
Identical sequences A0A0K0FRD0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]