SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0HXY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K0HXY7
Domain Number 1 Region: 1-162
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.57e-23
Family SMI1/KNR4-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K0HXY7
Sequence length 188
Comment (tr|A0A0K0HXY7|A0A0K0HXY7_BACPU) Uncharacterized protein {ECO:0000313|EMBL:KIL11061.1} KW=Complete proteome OX=1408 OS=Bacillus pumilus (Bacillus mesentericus). GN=B4107_1675 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MSFKQIKDKLYQYTIDIRSTKTISSLYEMKEIEEENAYHISPDYKSFISEYGECWIEDNV
YTHLREKPVWLVGESVPVELFYGLEQNDYDIREAIKTYKDQLPEQIIPIADADGGDLICL
DVSKINQGKIYFWDHELRDREQDLFLIADTFTEFIEGLFVVEDDEDSDTEDIDIQLSDDL
IKMLKERD
Download sequence
Identical sequences A0A0K0HXY7
WP_041109172.1.44172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]