SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0KVP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0K0KVP7
Domain Number - Region: 87-111
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0494
Family Archaeal tRNA CCA-adding enzyme substrate-binding domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K0KVP7
Sequence length 134
Comment (tr|A0A0K0KVP7|A0A0K0KVP7_9CAUD) Putative membrane protein {ECO:0000313|EMBL:AIR93566.1} KW=Complete proteome; Reference proteome OX=1542477 OS=Prochlorococcus phage P-TIM68. GN= OC=Viruses; dsDNA viruses, no RNA stage; Caudovirales; Myoviridae.
Sequence
MKSFGLLILRICIGAMLIHHGYEKLENIPNFANAFVKPLGLPFPEFFSYVAAYSEIVGSW
LLITGLFTRIGALFIVGTITFAIYHAIMTSGFNIYLLELLVLYFGGAFCVLLLGGGGFAI
DRFIKFKQAHVPFL
Download sequence
Identical sequences A0A0K0KVP7
MES00005178594 YP_009213741.1.60877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]