SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0S9M8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K0S9M8
Domain Number 1 Region: 2-139
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.09e-24
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K0S9M8
Sequence length 143
Comment (tr|A0A0K0S9M8|A0A0K0S9M8_BACT3) Uncharacterized protein {ECO:0000313|EMBL:AKR35988.1} KW=Complete proteome OX=180850 OS=Bacillus thuringiensis subsp. indiana. GN=NF53_2910 OC=Bacillus cereus group.
Sequence
MWKDTIHSISSNLSLKNPATKDELTDIQKCLHVELPNDLYQLLQETNGIEGEYGDFIWSA
SKIKTENMSMRNIVDFKDLYMPFDCLLFFADGGNGDLFGYSILKGKVQRDDIYVWNHEND
SRTWVAPSLKTFMEWWESGKIIL
Download sequence
Identical sequences A0A0K0S9M8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]