SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0SAA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0K0SAA4
Domain Number - Region: 122-225
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0133
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K0SAA4
Sequence length 233
Comment (tr|A0A0K0SAA4|A0A0K0SAA4_BACT3) Tuperoxide dismutase {ECO:0000313|EMBL:AKR36226.1} KW=Complete proteome OX=180850 OS=Bacillus thuringiensis subsp. indiana. GN=NF53_3148 OC=Bacillus cereus group.
Sequence
MSSKLDILREYNEDIQLINANEFKNINASLIPDLWVEVFSEHNREKRIKKILSIWKKYVD
NNLSNTIAYLSEYLEDIELMISEDTYSILYTIKNQGGEDLYYEGRNPKDSFNNEELESSW
REIPESIRDFYENVHNGFYDYTSESMGLMPLEAITYFGDDDLEWGIIDELEEPIKINLKT
SFGFFSNGMGSYIAIDYENCKNNNATFWSAKSQPKYNVHFWDFVDEWIVIGFE
Download sequence
Identical sequences A0A0K0SAA4 A0A0U0N5X8 A0A0W7YB60 A0A135WX54 A0A150CL39 A0A193CUT5 A0A1W2GL59 A0A243CIW1 A0A243JLR8 C2P0V5
WP_000095661.1.10745 WP_000095661.1.23307 WP_000095661.1.26483 WP_000095661.1.26872 WP_000095661.1.26965 WP_000095661.1.27931 WP_000095661.1.35694 WP_000095661.1.42485 WP_000095661.1.45720 WP_000095661.1.51681 WP_000095661.1.63789 WP_000095661.1.66999 WP_000095661.1.72484 WP_000095661.1.74863 WP_000095661.1.77567 WP_000095661.1.81570 WP_000095661.1.87777 WP_000095661.1.9623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]