SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0SZJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K0SZJ0
Domain Number 1 Region: 50-142
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000719
Family Collagen-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K0SZJ0
Sequence length 175
Comment (tr|A0A0K0SZJ0|A0A0K0SZJ0_9PROT) Uncharacterized protein {ECO:0000313|EMBL:AKR44640.1} KW=Complete proteome OX=1662285 OS=Methylophilus sp. TWE2. GN=ACJ67_08005 OC=Methylophilaceae; Methylophilus.
Sequence
MNMSIVKGLAIAALASFAVNAGATTVTLGAGSSTLPMVVAAGGILGPTVSFNDIFNFTLA
GPGKISYQISEKEVVFGYPDPSSSLGFSVAQIYDISDTSFTYGLYNASNALVTDLNNLTS
GAYYIKVSGTTTGLFGGQYTLKTTITAVPEPETNLMMLLGLAAIGTLTYRKKNSL
Download sequence
Identical sequences A0A0K0SZJ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]