SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0VGD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K0VGD8
Domain Number 1 Region: 2-108
Classification Level Classification E-value
Superfamily gp120 core 1.27e-55
Family gp120 core 0.0000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K0VGD8
Sequence length 108
Comment (tr|A0A0K0VGD8|A0A0K0VGD8_9HIV1) Envelope glycoprotein {ECO:0000313|EMBL:AKR75956.1} OX=11676 OS=Human immunodeficiency virus 1. GN=env OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
TFYATGDIIGDIRQAHCNISEGKWNKTLEGVKNKLAQYFPHKTIKFAPSSGGDLEITTHS
FNCRGEFFYCDTSGLFNSDLFNNTESNSSITIPCRIKQIINMWQEVGR
Download sequence
Identical sequences A0A0K0VGD8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]