SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0WSG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K0WSG5
Domain Number 1 Region: 15-169,197-226
Classification Level Classification E-value
Superfamily Prim-pol domain 1.74e-24
Family PriA-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K0WSG5
Sequence length 234
Comment (tr|A0A0K0WSG5|A0A0K0WSG5_9BBAC) Lef-1 {ECO:0000313|EMBL:AKS25402.1} KW=Complete proteome OX=1986290 OS=Clostera anastomosis granulovirus B. GN=clas59 OC=Viruses; dsDNA viruses, no RNA stage; Baculoviridae; Betabaculovirus.
Sequence
MRYTDEQLKRVWMGVAFKEDRYWAFMKFNGSWHHSDSKYSKHKTFNSYELFYDFCKQNDV
QDIHVKMLVDGSREWVIDVDHNDTDHEKIQLKNMITHATLGTFFAQNCTKIVYSGNRGLH
VWLDINEFDLKTNKRIRTYYYDSMLTSPKTIIAPFVQPGSLHECFIKSFDNMWIRRNINK
LYSHIKLEDMTALVKEFYPYVDKQVFVSNKQIRAPYSFNTKGGKFSSDHELVVE
Download sequence
Identical sequences A0A0K0WSG5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]