SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0Y544 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K0Y544
Domain Number 1 Region: 2-158
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 2.22e-54
Family Obg GTP-binding protein N-terminal domain 0.00000537
Further Details:      
 
Domain Number 2 Region: 151-323
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.86e-47
Family G proteins 0.0000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K0Y544
Sequence length 344
Comment (tr|A0A0K0Y544|A0A0K0Y544_9RHOB) GTP-binding protein Obg {ECO:0000256|HAMAP-Rule:MF_01454} KW=Complete proteome; Reference proteome OX=1458307 OS=Octadecabacter temperatus. GN=OSB_15570 OC=Rhodobacteraceae; Octadecabacter.
Sequence
MNFLDLCKVYIRSGSGGGGCISFRREKHIEYGGPNGGDGGKGGSVIVEAVDNLNTLIDFR
YQQHFFAKNGEAGKGQQRTGADGNDIVLKVPTGTEIMDEDQETVIVDLAETGQRVVLAKG
GNGGWGNLHFKSATNQAPRRSNPGQDGIERTIWLRLKLIADAGLLGLPNAGKSTFLAATS
NARPKIADYPFTTLVPNLGVVGVDNTEFVIADIPGLIEGASDGKGLGQLFLGHVERNSVL
LHLIDGTSGDPVGDYKTIIAELEAYGGHLADKPRVTVLNKIDTLDEEERQFIVDEIKAGT
GVDVMLMSGATGEGTVDVLRALKVEIDADKERQNAPEEEAPWRP
Download sequence
Identical sequences A0A0K0Y544
WP_049834432.1.1699 WP_049834432.1.77863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]