SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K1DW82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K1DW82
Domain Number 1 Region: 3-150
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000301
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K1DW82
Sequence length 155
Comment (tr|A0A0K1DW82|A0A0K1DW82_PSESF) Uncharacterized protein {ECO:0000313|EMBL:AKT32869.1} KW=Complete proteome OX=1095103 OS=Pseudomonas syringae pv. actinidiae ICMP 18884. GN=IYO_025770 OC=Pseudomonadaceae; Pseudomonas; Pseudomonas syringae.
Sequence
MNMFSTKLSKIITLYTAQGYDFNEGASQNELEDFVSRCKNTLDFLPPEDYLKVLEQHNGI
VVEGVFLYSTTPIKYTDSDGYCLEFIDMNLLSRELKWKDTFIIFGDSDQDEYVLDLTAAR
YQVRDKQAFDNVYEEFGTFTGLLEYMLDLMIGRIE
Download sequence
Identical sequences A0A0K1DW82
WP_020365848.1.101089 WP_020365848.1.101562 WP_020365848.1.11179 WP_020365848.1.11501 WP_020365848.1.13399 WP_020365848.1.13535 WP_020365848.1.14609 WP_020365848.1.15140 WP_020365848.1.19280 WP_020365848.1.2043 WP_020365848.1.21006 WP_020365848.1.2158 WP_020365848.1.2278 WP_020365848.1.23399 WP_020365848.1.25273 WP_020365848.1.25719 WP_020365848.1.25763 WP_020365848.1.25769 WP_020365848.1.25775 WP_020365848.1.27572 WP_020365848.1.29094 WP_020365848.1.29938 WP_020365848.1.32392 WP_020365848.1.33925 WP_020365848.1.34155 WP_020365848.1.36147 WP_020365848.1.36658 WP_020365848.1.37064 WP_020365848.1.38291 WP_020365848.1.39561 WP_020365848.1.39745 WP_020365848.1.39752 WP_020365848.1.42849 WP_020365848.1.43260 WP_020365848.1.43591 WP_020365848.1.46603 WP_020365848.1.47589 WP_020365848.1.49357 WP_020365848.1.50205 WP_020365848.1.52 WP_020365848.1.52606 WP_020365848.1.53172 WP_020365848.1.54854 WP_020365848.1.56223 WP_020365848.1.58187 WP_020365848.1.58792 WP_020365848.1.61888 WP_020365848.1.62649 WP_020365848.1.65245 WP_020365848.1.65278 WP_020365848.1.66425 WP_020365848.1.6906 WP_020365848.1.69607 WP_020365848.1.74383 WP_020365848.1.75381 WP_020365848.1.77084 WP_020365848.1.77888 WP_020365848.1.78346 WP_020365848.1.78642 WP_020365848.1.79158 WP_020365848.1.80878 WP_020365848.1.82522 WP_020365848.1.85088 WP_020365848.1.87287 WP_020365848.1.91712 WP_020365848.1.91766 WP_020365848.1.92016 WP_020365848.1.92448 WP_020365848.1.95348 WP_020365848.1.95779 WP_020365848.1.96947 WP_020365848.1.97987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]