SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K1EFY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K1EFY8
Domain Number 1 Region: 22-150
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000405
Family SMI1/KNR4-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K1EFY8
Sequence length 196
Comment (tr|A0A0K1EFY8|A0A0K1EFY8_CHOCO) Uncharacterized protein {ECO:0000313|EMBL:AKT39786.1} KW=Complete proteome; Reference proteome OX=52 OS=Chondromyces crocatus. GN=CMC5_039370 OC=Sorangiineae; Polyangiaceae; Chondromyces.
Sequence
MDSDLAESVAALKDIFTRRGIPATFGKSDPAVIEELRKTLRIPSRYRAFLLEADPVDVET
ATPVERVRLIPASKLAAEQVGVTNGEAAAPPGWRKSWVLIGRSALLGDPYFLDISKLDAE
GDCPVFTCMQGTESLKPELCASSFQQFLRILATAMEVATGFRENDVDDEDEAIFREALAP
KIKTLDSAALRAGHWT
Download sequence
Identical sequences A0A0K1EFY8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]