SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K1EIN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K1EIN8
Domain Number 1 Region: 27-87,122-198
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000471
Family SMI1/KNR4-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K1EIN8
Sequence length 242
Comment (tr|A0A0K1EIN8|A0A0K1EIN8_CHOCO) Uncharacterized protein {ECO:0000313|EMBL:AKT40547.1} KW=Complete proteome; Reference proteome OX=52 OS=Chondromyces crocatus. GN=CMC5_047030 OC=Sorangiineae; Polyangiaceae; Chondromyces.
Sequence
MSESFLHLFQEVVSVLRSHPEVVVYDVTVRSPASELDITAAERAMRRPMPDDLRAFYRAH
DGVFLSWGLEGRDVTEPLEPFGFPEYGAPPGVINLLPVAKAFSANWVARDLINWPAEAHR
VIYGVEAEDDEEDDDGPERVRAALLDHDSRYQPTSLVLGPPDQPAWTLIAHDHGADMLSS
SLSTFTTYLAVTLARWGTNRMPVYRPVRTRGTATPGVPVIDGPKEHPSLDEIVEELRKSA
AS
Download sequence
Identical sequences A0A0K1EIN8
WP_050432468.1.60178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]