SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K1EP77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K1EP77
Domain Number 1 Region: 265-373
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000144
Family SMI1/KNR4-like 0.0095
Further Details:      
 
Domain Number 2 Region: 7-46
Classification Level Classification E-value
Superfamily UBA-like 0.0000319
Family TS-N domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K1EP77
Sequence length 425
Comment (tr|A0A0K1EP77|A0A0K1EP77_CHOCO) Uncharacterized protein {ECO:0000313|EMBL:AKT42462.1} KW=Complete proteome; Reference proteome OX=52 OS=Chondromyces crocatus. GN=CMC5_066880 OC=Sorangiineae; Polyangiaceae; Chondromyces.
Sequence
MSNNDPVSIAKIRQVRARVEVSLAEAKAALTATDGDVAAAIARLMTPEQEARDRNHAIAW
KIVDGSAPSEARPPPDAKPDVSPPPPPPPPLSALDRAAWVQAQIDERRPAAHVEGSIGRI
VQELARGVHGLEHQGPDVFGMEVPPAERAGLSVLAEEARAALLAWRDECVRREGDAGAQF
VAAIAGRVGVLLEPERDHLDLPGSDRLAAVQAAFARVTDLLSDPPALISWWHQNGGLGDG
QVEVRIQTSDGAALQHLAGTRHAGYGAALPAEYLWFLTQTNGLTVLAENDAPALLVAPIE
SIDHDHFDAVPVEGLDSPFVFGDIDGYGALAFDATATLRDPRPVFWIEGDDAPRATRIAD
SFADFIERLCDAHLRLPTLLAASGISVPPSLEKPRPASTEPHAAHRNLRPPRSSPTPRRR
RRVRE
Download sequence
Identical sequences A0A0K1EP77
WP_050434091.1.60178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]