SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K1LDT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0K1LDT1
Domain Number - Region: 275-379
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00101
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K1LDT1
Sequence length 737
Comment (tr|A0A0K1LDT1|A0A0K1LDT1_9POXV) Uncharacterized protein {ECO:0000313|EMBL:AKU40423.1} KW=Complete proteome; Reference proteome OX=28873 OS=Camelpox virus. GN=TT95_00065 OC=Orthopoxvirus.
Sequence
MISVTDIRKAFLDNECHTITKAFGYLHEDKAIALIKIGFHPTYLPKVLYNNVVEFVPEKL
YLFKPRTVAPLDLISTITKLKNVDKFASHINYHKNSILITGDKSLIVKCMPYMIISDDDI
RFIREQFVGTNSIEYILSFINKESIYRMSYQFSENEIVTIINRDHFMYEPIYEHQVLDSD
FLKTMLDRYGIVPINSGIIDELCPEAIIEILMAVVRPRDAIRFLDIVNKNQLTEDSVKNY
IINDIRRGKIDYYIPYVEDFLEDRTEDLGIYANIFFEDAIDITKLDITKTELEHISKYMN
YYTTYIDHIVNIILQNNYIDILASIIDYVQDVLTEELCIRIVCESTNPVPVTSLPIHSTL
VMVMCIQMKYVDIVEFLDEIDIDTLIEKGADPITEYTFTTRWYNKHNDLITLYIKKYGFC
PMMMKRLMFEYPLTKEASDHLLKTMDENRGAIMFFPRTICTLPYLLCCNYKLIQKPIPFK
EENRNIVYKKTNRVLCFDSLENSAFKSLIKIDSIPGLKTYNMKDITYEKSNNIICVRFIP
QESIHNEERRIKSQFFDIARLASYGLYYIPSRYLSSWTPVVNMIEGREYTNPQKIECLVI
LDLFSEEFIEYQNLGNAVSNKYELEYTISNYQAAINCLMSTLLIYLVLGSIRSISRTEKF
VLSILNIFYKGLKINKLLSEPVSGVCIELDKIKDRASSGDSSFIFLKKNELSKTLSLCEK
VCIETILDNNQSFKSSK
Download sequence
Identical sequences A0A0K1LDT1 Q775Y3 Q8V2W3
gi|18640288|ref|NP_570444.1| NP_570444.1.3826 Q775Y3_CAMPS Q8V2W3_CAMPM

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]