SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K1N4L8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K1N4L8
Domain Number 1 Region: 128-269
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 3.37e-46
Family AadK C-terminal domain-like 0.0000579
Further Details:      
 
Domain Number 2 Region: 1-123
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.96e-35
Family AadK N-terminal domain-like 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K1N4L8
Sequence length 273
Comment (tr|A0A0K1N4L8|A0A0K1N4L8_AGGAP) Aminoglycoside adenylyltransferase {ECO:0000313|EMBL:AKU64010.1} KW=Complete proteome OX=732 OS=Aggregatibacter aphrophilus (Haemophilus aphrophilus). GN=ADJ80_09755 OC=Pasteurellaceae; Aggregatibacter.
Sequence
MRTETEILDVILQTAKVLQVDAVALSGSRATPKALKDEFQDYDVVYLVENLDSLVDDLAW
LDRFGKRMIEQHISLEHRRLFLMLFEDGNRIDLTLCPKEHIKEWLDSEADFTVLTDPHGL
FQAHASTPRRYWMAPATATDFEKSCNEFWWVSAYVVKGIRRHQLIYAADHLYEICQKELF
KLLAWQVAANKGPVDVGKNYKYLFQYLPAEKEKALVALFDFSNQENLTQSLLATQIFFHQ
EAQSFSHKTGFSYDKETAEKMLEYTKEKLDRID
Download sequence
Identical sequences A0A0K1N4L8
WP_050693937.1.32194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]