SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K1NBK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K1NBK2
Domain Number 1 Region: 4-141
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000183
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K1NBK2
Sequence length 152
Comment (tr|A0A0K1NBK2|A0A0K1NBK2_9BURK) Uncharacterized protein {ECO:0000313|EMBL:AKU66208.1} KW=Complete proteome; Reference proteome OX=1658672 OS=Ottowia sp. oral taxon 894. GN=ADJ79_01235 OC=Comamonadaceae; Ottowia.
Sequence
MTLTDLQSLYPDFCGDFSPDWGLPTRADFERLEKEFSVVFPPSFIEFQTLHAAQMRAVGE
GFRWANAPEPHLSLESLLRQAQERGHLALGLLPFWQDGGDALAFDVSAAQAEPPVVWCMR
DGSAFALADGFVPWLAACYEDLRRDLMSHFNL
Download sequence
Identical sequences A0A0K1NBK2
WP_050714434.1.88385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]