SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K1NMV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K1NMV0
Domain Number 1 Region: 10-136
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.72e-17
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K1NMV0
Sequence length 138
Comment (tr|A0A0K1NMV0|A0A0K1NMV0_9BACT) 1,3-beta-glucan synthase regulator {ECO:0000313|EMBL:AKU70417.1} KW=Complete proteome OX=1236517 OS=Prevotella fusca JCM 17724. GN=ADJ77_11680 OC=Prevotella.
Sequence
MEFEQTEQQLTTAELAAFEQQFNIKLPMAFKEHYLKHNGGYPPYEYVKGIANVLTINGFY
PIKYGRLPVEKIIADYGKSGIVFDGKIPFAYDNGGNMYLISLEADTYGHIFIIETEFLED
KNYTLVSKSFTDFLGSFH
Download sequence
Identical sequences A0A0K1NMV0
WP_025078207.1.33395 WP_025078207.1.94113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]