SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K1YY51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K1YY51
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 7.52e-35
Family AadK N-terminal domain-like 0.0000358
Further Details:      
 
Domain Number 2 Region: 112-143
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.00000000000251
Family AadK C-terminal domain-like 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K1YY51
Sequence length 144
Comment (tr|A0A0K1YY51|A0A0K1YY51_STAEP) Streptomycin resistance protein {ECO:0000313|EMBL:AKZ18230.1} OX=1282 OS=Staphylococcus epidermidis. GN=str OC=Staphylococcus.
Sequence
EGSRTNENIKKDKFQDYDFAFFVSDIEYFTHEESWLSLFGELLFIQKPEDMELFPPDLDY
GYSYIMYFKDGIKMDITLINLKDLNRYFSDSDGLVKILVDKDNLVTQEIVPDDSNYWLKK
PTEREFYDCCNEFWSVSTYVAKGV
Download sequence
Identical sequences A0A0K1YY51

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]