SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2DIV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2DIV4
Domain Number 1 Region: 1-258
Classification Level Classification E-value
Superfamily LigB-like 3.66e-86
Family LigB-like 0.00000558
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K2DIV4
Sequence length 258
Comment (tr|A0A0K2DIV4|A0A0K2DIV4_9RHIZ) Extradiol ring-cleavage dioxygenase {ECO:0000313|EMBL:ALA19739.1} KW=Complete proteome; Reference proteome OX=1702325 OS=Chelatococcus sp. CO-6. GN=AL346_14470 OC=Chelatococcaceae; Chelatococcus.
Sequence
MPTLFLSHGAPNLVLHNTEAHRFLKAFGAALPRPRAILVATAHFMTSAPALTADARPETI
YDFGNFEPELFRMTYPAPGDPALAARAAALLGEAGLAAGTVEGRGFDHGTWVPLKLLYPT
ADIPVVQLSVQPRSGPAHHLALGRALAPLRREGVLIVGSGALTHNLHELFGRGYALDAPA
PDWVSSFGEWMRAAIEEGRTDDLLDYRRKAPFGPENHPTEEHLLPLFVALGAAGEARGER
VHASAQYGVLMMDAYRFG
Download sequence
Identical sequences A0A0K2DIV4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]