SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2F491 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2F491
Domain Number 1 Region: 147-279
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 3.61e-29
Family AadK C-terminal domain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 6-133
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 6.11e-22
Family AadK N-terminal domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K2F491
Sequence length 284
Comment (tr|A0A0K2F491|A0A0K2F491_9BACL) Uncharacterized protein {ECO:0000313|EMBL:ALA40470.1} KW=Complete proteome OX=59893 OS=Paenibacillus peoriae. GN=ABE82_02525 OC=Paenibacillus.
Sequence
MNNAYEVLEERISEWGISNEEIIAVYIVGSRAREDKPFDEFSDLDVVVFSTNPDYYLQND
QWLLNIGKVWTSFMFRTAKGDPEKLVLFDQGAEVDFLFRHTSDLDHIIKNGHIPEGFQRG
VRMLLDKTGNGNQIIPQTTTIPGTPPISEGAYLQVVNMYCFASLYVAKQILRNDLWVAKQ
RDTDCKQLLLQMIEWHAKAVHGSEYDTWHAGKFINEWADQDVFADLKKSFGEYDPNHSWE
ALIVSLELFKRLSSEVAAKYKYAHPNELFSHIQAWLGGQYDKHR
Download sequence
Identical sequences A0A0K2F491
WP_023986769.1.78517 WP_023986769.1.90060 gi|565994885|ref|YP_008909969.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]