SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2FER9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2FER9
Domain Number 1 Region: 28-98,129-190
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000209
Family SMI1/KNR4-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K2FER9
Sequence length 473
Comment (tr|A0A0K2FER9|A0A0K2FER9_9BACL) SMI1/KNR4 family protein {ECO:0000313|EMBL:OMF49693.1} KW=Complete proteome OX=59893 OS=Paenibacillus peoriae. GN=ABE82_23750 OC=Paenibacillus.
Sequence
MTVHFAQTLEKLEQVVDRLRQSGMPDVVYQWTEGISTGELTELEERLQMHLPASLSELIK
RCGSLNLLWCLPQHCIVADGPECSYKNSNDLEQEQCILDDITGEFGWNHEYIGYFTSYGE
DTDSAADEQRYLILNYNGAGDPILLDMATSATEPAVFCYHHELDQFTLLAENLPAYIDTM
LTLHGLWLWDWFKVADEHGIQLNSPPLQMWQRWLNMFCTMKLEDAQSLETLIHYTTMHGV
DYPAVLQAFQAYDPKDIFLAWEQHWQNIQHSQVPFSTWAVLVGETAGIGAADWVRSLWEP
ETAQAWTSLAQNNTLHAKGAFASTRAYLSARCLPEQEGLVCVCNHLLQHSVAEDKLEGYT
ANGQLQHFRSPQIINWMRDKVNHPVDGWAILFAHSRPTAEQLIEWLSDSELHQKIATEAL
DIMIHRDPLPALEADAWANISDLLLASLQLVMLKKDKRRIEAVLKQLSDLELG
Download sequence
Identical sequences A0A0K2FER9
WP_053326293.1.44658 WP_053326293.1.90060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]