SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2FEX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2FEX8
Domain Number 1 Region: 28-60,101-159
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000373
Family SMI1/KNR4-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K2FEX8
Sequence length 179
Comment (tr|A0A0K2FEX8|A0A0K2FEX8_9BACL) Uncharacterized protein {ECO:0000313|EMBL:ALA44307.1} KW=Complete proteome OX=59893 OS=Paenibacillus peoriae. GN=ABE82_23730 OC=Paenibacillus.
Sequence
MSIFTGLQRPQFQAYYDEVFLIEHRFKNGMGFPPSYIDYVKTLGYGRLCGLWNIHIPLGD
HPDSWLHRYHNWRAWFDDLLGSEEVLQEAALEPDGFPELLEHAVPFASSEGNDLLIWDIQ
SPDERGEFPIYALNLCTWGNFRYAASDLYSLVEALVDEERVKSVLGTERTPFSYTFEPF
Download sequence
Identical sequences A0A0K2FEX8
WP_023990762.1.44658 WP_023990762.1.77953 WP_023990762.1.78517 WP_023990762.1.90060 WP_023990762.1.94972 gi|565994454|ref|YP_008914410.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]