SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2FFH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2FFH1
Domain Number 1 Region: 34-198
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000209
Family SMI1/KNR4-like 0.014
Further Details:      
 
Domain Number 2 Region: 213-431
Classification Level Classification E-value
Superfamily ARM repeat 0.00000137
Family PBS lyase HEAT-like repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K2FFH1
Sequence length 444
Comment (tr|A0A0K2FFH1|A0A0K2FFH1_9BACL) Uncharacterized protein {ECO:0000313|EMBL:ALA44653.1} KW=Complete proteome OX=59893 OS=Paenibacillus peoriae. GN=ABE82_25595 OC=Paenibacillus.
Sequence
MWFGKKETQLDRIKNKLSQAMRKDADFSVFGASSHQYRVKEKLTAKELVDWQVHNQVTLP
EPYAQFLTKIGNGGAGPYYGIYSIEKATSYTERQALLAKSVLHPGMTKEEWNHLIEPLTK
DEGIPDEEYDDTCNKVLGGMLCIGTQGCEYDMYLVLEGKYRGRIVYTSDFHPDHPFFFVY
EDSFLDWYERWLDEIILDYDIGWFGSRMPGDENALIQIYQSAPNEEIQAKALDGMFKFKK
VSQPTLAFLKNIAEQSPKNRTTAIWLICKTSFDTGRKYLLELLQSDEHEDFLQGLMILHS
SSKTVNLTEFIPVILQRLDRIHDPETLRYAGYILEDYGAITLHNFASFLCHADPKMQTTA
IYAARSCENKQESWQIIEQTLMGADPQVLNNSILYWGIIPHEKLLPYYKAVWPKYKSNPN
FREKFIGCLRELHLPDDYFDKDES
Download sequence
Identical sequences A0A0K2FFH1
WP_053326486.1.90060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]