SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2HAK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0K2HAK8
Domain Number - Region: 98-138
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00824
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K2HAK8
Sequence length 200
Comment (tr|A0A0K2HAK8|A0A0K2HAK8_GEOSE) Spore gernimation protein GerPC {ECO:0000313|EMBL:ALA70978.1} KW=Complete proteome OX=272567 OS=Geobacillus stearothermophilus 10. GN=GT50_13045 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MSIYEYFVKLHRYLLWQTKKIRALERRLHALEARLREMEAQPRTSIERIEYKFDQLKVET
LEGTLNIGIAPPGAGGTIEDFAVEPVKTVIPKPEPVLMRPIQEKVAAYLNGEASETLKRL
EQQYGRRLDDTYRQFILQDIARQTDERIRFYLQEKANHGYVPSGDRDEAVENEIFQKVKA
DIEQSLDAFLKHLPSKEGST
Download sequence
Identical sequences A0A0K2HAK8
WP_053414458.1.59104 APC35886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]