SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2IZ36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0K2IZ36
Domain Number - Region: 5-102
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.000683
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K2IZ36
Sequence length 127
Comment (tr|A0A0K2IZ36|A0A0K2IZ36_STEMA) Membrane protein {ECO:0000313|EMBL:ALA87486.1} KW=Complete proteome OX=40324 OS=maltophilia). GN=B9Y76_15470 OC=Stenotrophomonas maltophilia group.
Sequence
MKTMNTQRGMTLTSFLTVLIVVGFFLYIGMKLFPMYQEYYAVRSAMKSLANEPGVGSMEP
ARIQDLFFKRLYINYSDNVKPANVKFDRRDNGWTLKVNYEVRRQLIGNLDVVGKFDSSQD
LTRSGAQ
Download sequence
Identical sequences A0A0K2IZ36 A0A0L8A908 T5KLU4
WP_010482821.1.100833 WP_010482821.1.10738 WP_010482821.1.1211 WP_010482821.1.12365 WP_010482821.1.16072 WP_010482821.1.16596 WP_010482821.1.22719 WP_010482821.1.22973 WP_010482821.1.2335 WP_010482821.1.3235 WP_010482821.1.3261 WP_010482821.1.35772 WP_010482821.1.36422 WP_010482821.1.39469 WP_010482821.1.39844 WP_010482821.1.40955 WP_010482821.1.41077 WP_010482821.1.42380 WP_010482821.1.44206 WP_010482821.1.45403 WP_010482821.1.52013 WP_010482821.1.53173 WP_010482821.1.6040 WP_010482821.1.6217 WP_010482821.1.63410 WP_010482821.1.65951 WP_010482821.1.70371 WP_010482821.1.79838 WP_010482821.1.89109 WP_010482821.1.89178 WP_010482821.1.89344 WP_010482821.1.91578 WP_010482821.1.96337 WP_010482821.1.96643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]