SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2J8R0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2J8R0
Domain Number 1 Region: 34-85,120-193
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.24e-17
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K2J8R0
Sequence length 195
Comment (tr|A0A0K2J8R0|A0A0K2J8R0_9FUSO) SMI1 / KNR4 family protein {ECO:0000313|EMBL:ALA94807.1} KW=Complete proteome OX=712357 OS=Leptotrichia sp. oral taxon 212. GN=AMK43_00960 OC=Leptotrichia.
Sequence
MKMIDKIKEIEKYVCSNFEELDLDDPVEEGYFETYENISGVCQDDFAFFEKKFDIVLPDD
FKELYKYKNGSGFFFVLPAVIDKREMAFRLMSLQEIENSKKIFQNRDALLSEFPEYFTVQ
DIEKMNDNRIKPYLFNRKWFPFAEYCDSCYLMLDLDPDKDGKKGQIICYIHDPDEIVYAA
SNITELVSKIFEEIS
Download sequence
Identical sequences A0A0K2J8R0
WP_053391781.1.39199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]