SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2M8R3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2M8R3
Domain Number 1 Region: 6-140
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 6.8e-20
Family SMI1/KNR4-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K2M8R3
Sequence length 143
Comment (tr|A0A0K2M8R3|A0A0K2M8R3_CLOBE) SMI1/KNR4 family protein {ECO:0000313|EMBL:ALB44453.1} KW=Complete proteome OX=1428454 OS=Clostridium beijerinckii NRRL B-598. GN=X276_03730 OC=Clostridium.
Sequence
MAEIKWERIVEGVDDMTITKFEEKFSISFPKEYKECVIKYNGGHPIPNAFYFADKGEGVF
DHLLSFTSDPNIEDVYDIVSDYIPEKVIPFATDPFGNDICFDYRKNKQEPNIVFRNQDEV
GEEAIEFICETFVELLENLHEYN
Download sequence
Identical sequences A0A0K2M8R3 A0A1S8NSS2
WP_023973569.1.41106 WP_023973569.1.95078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]