SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2MFQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2MFQ8
Domain Number 1 Region: 6-123
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.00000000314
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.054
Further Details:      
 
Weak hits

Sequence:  A0A0K2MFQ8
Domain Number - Region: 146-257
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0455
Family AadK C-terminal domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K2MFQ8
Sequence length 265
Comment (tr|A0A0K2MFQ8|A0A0K2MFQ8_CLOBE) Oxalate:formate antiporter {ECO:0000313|EMBL:ALB46764.1} KW=Complete proteome OX=1428454 OS=Clostridium beijerinckii NRRL B-598. GN=X276_16705 OC=Clostridium.
Sequence
MIPINHKKFIDNSIKILKDDFRIVGIATGGSYITNEMDEYSDIDFIIAVDSNHYEEVMDE
RYKIAANLGTLLSAFTGEHVGEPRLLICLYGPELLHVDLKFVSIDNIAHRVEDPVILWER
GNFVSEALKENNARFPIPSLQWIEDRFWVWIHYGAAKIGRGEIFETIEFISSLRQMVIGP
LILMKNGELPRGVRKIEFVAPESISLLKETIPSYSIESCIKSLKMIIQIYLELREYFITE
DFIKRVEAEKYSINYLNKINHVSNS
Download sequence
Identical sequences A0A0K2MFQ8 A0A1S8NTU7
WP_023976938.1.16915 WP_023976938.1.65774 WP_023976938.1.95078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]