SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2NX94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2NX94
Domain Number 1 Region: 9-145
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000249
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K2NX94
Sequence length 146
Comment (tr|A0A0K2NX94|A0A0K2NX94_9ENTR) Cell wall assembly/cell proliferation coordinating protein {ECO:0000313|EMBL:ALB65091.1} KW=Complete proteome OX=1159554 OS=Cronobacter dublinensis subsp. dublinensis LMG 23823. GN=AFK67_00730 OC=Enterobacteriaceae; Cronobacter.
Sequence
MVELVDAEKHIDENEFIEFAKGFARPLPDSFKDHYLRINGGCLGEEDVEADRWGIPIGGF
NPIKYGQLTIEELITDIDTIAPAESEYGPWHAKAFVPFAYDNGGNTVFMSLKECDYGCVY
IYAQDGDDLFEVADSFDDFLDALYKR
Download sequence
Identical sequences A0A0K2NX94 K8AH99
WP_007710985.1.21494 WP_007710985.1.32867 WP_007710985.1.58412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]