SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2PHY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2PHY3
Domain Number 1 Region: 14-128
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000196
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K2PHY3
Sequence length 178
Comment (tr|A0A0K2PHY3|A0A0K2PHY3_9ENTR) Nuclease {ECO:0000313|EMBL:ALB72385.1} KW=Complete proteome OX=1159613 OS=Cronobacter muytjensii ATCC 51329. GN=AFK63_17950 OC=Enterobacteriaceae; Cronobacter.
Sequence
MLLTIPEIEKKLHEKFDPFQGEMDDLILKKRSSALANITILETKLNIKICNDFLSFLNTY
DLDNFSLGNVAFGSGDNYINTLIELNEDNGFNHWWVGNKRPEGVILIAISDPYSILLNNN
DNKVYGITGESYQYQENEVSINFELFVRGVGTLFLKEGTASEVASAVGAVNLDFWQSL
Download sequence
Identical sequences A0A0K2PHY3
WP_038866153.1.70246 WP_038866153.1.8442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]