SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2PHY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2PHY9
Domain Number 1 Region: 4-94
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000288
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K2PHY9
Sequence length 117
Comment (tr|A0A0K2PHY9|A0A0K2PHY9_9ENTR) Uncharacterized protein {ECO:0000313|EMBL:ALB72383.1} KW=Complete proteome OX=1159613 OS=Cronobacter muytjensii ATCC 51329. GN=AFK63_17940 OC=Enterobacteriaceae; Cronobacter.
Sequence
MNKHIENIETDRKIKFPPLYKQFLANEIKDSDTYEINSKDDGTIYLYSYIDLVERNETYD
IQSVEPFYFLIGQDGDLGYFIYVESGKESDVIFSVDLGALGSLEMNEEAKDIYSLSA
Download sequence
Identical sequences A0A0K2PHY9
WP_038866151.1.70246 WP_038866151.1.8442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]