SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2TVX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2TVX6
Domain Number 1 Region: 2-41
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000123
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K2TVX6
Sequence length 407
Comment (tr|A0A0K2TVX6|A0A0K2TVX6_LEPSM) Sperm autoantigenic protein 17 [Columba livia] {ECO:0000313|EMBL:CDW29832.1} OX=72036 OS=Lepeophtheirus salmonis (Salmon louse). GN=SPA17 OC=Copepoda; Siphonostomatoida; Caligidae; Lepeophtheirus.
Sequence
LTLPSGLEDILEGLAKEVLRHKPSDIYEFSALHFEDLLRRRDGLCTSYYDDFGTKGSILS
DIENVQTLDNEETPDITIEPFDNPFEEPSDECDIEYNDVLTRTKSIDIQLPTRVIGVDND
SVTDVHDFLTNEDSSTNECTLEDNCGNLSDIERPKTPNPENNHIRPTENAATQIQSGFKG
MSSRGRKVIDSEKKTGEVTTEPMKKEKKYDQYYISNRSIGINCAASLIQAVFKGYLTRQH
FKKKSKDKIKFERPDHIESEVITIIGSETCNNIDTYKSSFMSIQAEALQNEELEQNESHK
IKVDLTNIMSLSNLDLIEQTTMTPVKDETTVFLNKSLAHSNINQIHDNNSEPNDLMSDFL
AIKPAKKLTNFNSDVDTNEINLLSTVENTNSPNFRINEPVDSYITII
Download sequence
Identical sequences A0A0K2TVX6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]