SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2U4M5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2U4M5
Domain Number 1 Region: 6-91
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.000000000177
Family Crystallins/Ca-binding development proteins 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K2U4M5
Sequence length 117
Comment (tr|A0A0K2U4M5|A0A0K2U4M5_LEPSM) Crystallin, gamma D [Odobenus rosmarus divergens] {ECO:0000313|EMBL:CDW33173.1} OX=72036 OS=Lepeophtheirus salmonis (Salmon louse). GN=CRYGD OC=Copepoda; Siphonostomatoida; Caligidae; Lepeophtheirus.
Sequence
MKYNTLNLYEESGFMGDEKYFYSDTPSLYHDNFGKSIILTGCQPWTLYEHTSYRGDHICI
YPSSTQNCEPGFYLEPQDFGYFVNKVSSIRMGCFSKKVFKGVVVPANSTRIFTPKQL
Download sequence
Identical sequences A0A0K2U4M5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]