SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2UAQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2UAQ2
Domain Number 1 Region: 453-655
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000131
Family Fibronectin type III 0.0047
Further Details:      
 
Domain Number 2 Region: 317-523
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000295
Family Fibronectin type III 0.0053
Further Details:      
 
Domain Number 3 Region: 161-202
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000157
Family Fibronectin type I module 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K2UAQ2
Sequence length 761
Comment (tr|A0A0K2UAQ2|A0A0K2UAQ2_LEPSM) Putative epidermal cell surface receptorlike [Apis florea] {ECO:0000313|EMBL:CDW35150.1} OX=72036 OS=Lepeophtheirus salmonis (Salmon louse). GN= OC=Copepoda; Siphonostomatoida; Caligidae; Lepeophtheirus.
Sequence
AGTEFEGISLGEFETLYHNVKGHVYAYNESTLFIQDFSYDGTGPDAYFWIGINSPTPNSD
GLLIQYPDNGENDSSSSGYEVDAPVLGAYDKENIVLRLPEGITADQLKWISVWCRAFAVD
FGHLIIPQDVLETVQVSEKLTQKEEDLFYPITETLPIRKKDTCLHKGQEHQRDQVFYDGC
EQFCVCLENGETYCNPIECPSDFGLDVINPFCLEWNEHKDFIAEVPMCCPPVPVCISDGT
CQYSGYSFKNYDNIPQNLTGCEKSCYCNDGEVQCQDACYSLPEEPPSYLPCIPEQSVIQP
KEDRPCCNMWTCTKLEDLPDTIEGGSAYPLNSTFIEIELEAPRALGGRPGFYKILLGEGS
EAGASPEEWTPRVVTPENGIFSLQPDGTLRLVLGGLLPEQKYFLRVDVHIKTSNNDAVHK
KIIKSKIISVQLLDAEEPPAPKLIKKASNFYLKAERIEPHSALVTWRYLTLYEKNYIDGV
QIRYNSMENGEETSQVPETTPFIHRDTNFYQITELASNTEYKVDLYFIPVSNTTVEYTSI
PQGGVLFKTSEPRVDPYDFKLKLNADDIGDRWMRLSWSGIPNPYQKYVSIFRLAYMEVND
VESRSIFKIANMETDNILNLLHLEPSTPYQVWLEAYLTNGRVAKSELLDISTKEGVYTEA
ESEGLKENPRLNNGEEVDTYYGSMVTAVVFAVLFALALLAISFLYLRRTTTYKAIISGGA
AKMSKNNNGQDNQSTSIPMSSQNGNNTDRNGKKLSDQMSSI
Download sequence
Identical sequences A0A0K2UAQ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]