SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2V324 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2V324
Domain Number 1 Region: 86-140
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000108
Family Fibronectin type II module 0.0043
Further Details:      
 
Domain Number 2 Region: 24-61
Classification Level Classification E-value
Superfamily Kringle-like 0.000000106
Family Fibronectin type II module 0.0061
Further Details:      
 
Domain Number 3 Region: 155-182
Classification Level Classification E-value
Superfamily Kringle-like 0.00000828
Family Fibronectin type II module 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K2V324
Sequence length 184
Comment (tr|A0A0K2V324|A0A0K2V324_LEPSM) Putative LOC100215884 [Hydra vulgaris] {ECO:0000313|EMBL:CDW44542.1} OX=72036 OS=Lepeophtheirus salmonis (Salmon louse). GN= OC=Copepoda; Siphonostomatoida; Caligidae; Lepeophtheirus.
Sequence
TMGHIRDMIVLFIMVAVVPTLCEGCFTTQGDLCIFPFVYNGIKFDGCTNSGYGELFWCPT
AINSTGGISNIGVCRNKCPRISTTLVHTNCTTVDGRFCVFPFTYKGEKYNKCTKADSGRS
FWCATSLGQFGEIKSYGECKETCNRTAFPSVEDGCQTTTGHKCIFPFAYNGDKYYECVGM
NNHG
Download sequence
Identical sequences A0A0K2V324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]