SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2V7F3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2V7F3
Domain Number 1 Region: 97-299
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.83e-28
Family Eukaryotic proteases 0.0028
Further Details:      
 
Domain Number 2 Region: 23-65
Classification Level Classification E-value
Superfamily Kringle-like 0.0000591
Family Fibronectin type II module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K2V7F3
Sequence length 300
Comment (tr|A0A0K2V7F3|A0A0K2V7F3_LEPSM) Uncharacterized protein {ECO:0000313|EMBL:CDW46468.1} OX=72036 OS=Lepeophtheirus salmonis (Salmon louse). GN=Dmoj\GI20401 OC=Copepoda; Siphonostomatoida; Caligidae; Lepeophtheirus.
Sequence
MKIITVWIFLQSLIFANGKECTTPSGDCLFPFTYRGTHKICTLVDTSIYPKPWCYLKNGQ
WDYCSDDCFDCGVSNDLGNSCNQQKEGSQGFFDNAVFPWHAHIVNRENQQVLCNGVIVSN
DRVLTTANCKGYYHKHGINIYAGSGTYYNNDGYQDGRVKSFVAHEGYNMKTGENNIAVIG
LHNRLVWNDRVLPICFSNDYFPIKEGQSATFSGSDIVFTWSNVPSVHFSIVKKLRENIHK
DCQKKDHLCTTKNSVSEGENEGGPLTICQDLKRCVLVGILSSIKENQNILVFTNISMHIK
Download sequence
Identical sequences A0A0K2V7F3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]