SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2WDJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2WDJ1
Domain Number 1 Region: 136-230
Classification Level Classification E-value
Superfamily ARM repeat 0.00000158
Family PBS lyase HEAT-like repeat 0.053
Further Details:      
 
Domain Number 2 Region: 3-117
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000122
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K2WDJ1
Sequence length 239
Comment (tr|A0A0K2WDJ1|A0A0K2WDJ1_ANEMI) Uncharacterized protein {ECO:0000313|EMBL:CEH28819.1} KW=Complete proteome OX=47500 OS=Aneurinibacillus migulanus (Bacillus migulanus). GN=BN1090_A2_01242 OC=Aneurinibacillus group; Aneurinibacillus.
Sequence
MGIDEINKNLQLHLPQNSMECLRLHARKQAENEFFLRLMNGDEIIELLSYLRENNVYKDI
CPFWTDDHSNYVAIYISGPLKYRVCYVDHEETDLSPAFRSIDTFIHAVEEDDTADWHDLK
KDYPSTDSTIKEKQDDLQAVQALQKILDEYKEIDEEIRCQYIFSIMALTPSESLDMLLHY
VDDEDMYVQERACEILGFHQYVPARDKLRTIAETGMHNGKLAAKRALEKIRAKRKEREV
Download sequence
Identical sequences A0A0K2WDJ1
WP_043070077.1.20291 WP_043070077.1.75110 WP_043070077.1.81519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]