SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K3B7H6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K3B7H6
Domain Number 1 Region: 23-106,143-198
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000559
Family SMI1/KNR4-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K3B7H6
Sequence length 226
Comment (tr|A0A0K3B7H6|A0A0K3B7H6_9PSEU) Uncharacterized protein {ECO:0000313|EMBL:CTQ93569.1} OX=703222 OS=Kibdelosporangium sp. MJ126-NF4. GN= OC=Kibdelosporangium.
Sequence
MSLPDVETSWNRIRASLAQRAPDLLATIRPPATEPDIAAAEEAVGVALPADLLAWWRLAD
GRADGPGHLLPRWFDPYPVASALRSRKSWTDVWRNAEDNYFASEDGWMHRELLAWAGGQR
PTVDDRIAALMAEPAGTPCEGMYLPVWLPIADSRMGTDLFVDLRDGPLRGCVMSFDNVGT
AQADPTWPSVTAMLAEVANALAGSEIVVDGDPVRAEVDERGHLTWE
Download sequence
Identical sequences A0A0K3B7H6
WP_042177600.1.17128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]