SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K6G8G0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K6G8G0
Domain Number 1 Region: 104-194,221-284
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000445
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K6G8G0
Sequence length 581
Comment (tr|A0A0K6G8G0|A0A0K6G8G0_9HOMO) KNR4/SMI1 homolog 2 [Debaryomyces hansenii CBS767] {ECO:0000313|EMBL:CUA74902.1} KW=Complete proteome; Reference proteome OX=456999 OS=Rhizoctonia solani. GN=RSOLAG22IIIB_01534 OC=Agaricomycetes; Cantharellales; Ceratobasidiaceae; Rhizoctonia.
Sequence
MSFLSSISSFFGGQSSASAGNRTTRTRTLTSTHDAFSLPTHSPSTSHRDRVDSPGPQFSY
PPAAAYSSSPTGFDYMPQATRDNFRRSTLNSPGLSGPSSLATTWDRIRKFMAREYPELGD
SLNFGLAPAIIDQVEAELGMTLPKAVRESYLLCDGQEAESGTACAEGLFFGLTLLPLEEV
VDEWRFWREVDEDPATGANPQLLQVMASIPTGWIRKAYSCRGWLPLVTDRAGNYLGVDLA
PAEQGTYGQVIVFGRDFDTKVVMFRGEGEEGWATWLQSFVEELETGEGFEVGASDSASEG
SDDVGYESYFYDGSGRSKGVGGARDGTAGIKLTGEYKGWNILEAFADKSYRRWRERDMAP
DLDLLQNPVIVPQNVQLVGPGVGTGSGVEVPIPIMGGASSPSTPTRSRLAPMPPVPPNPD
PPSMGKLDQPIPPTIQVTRASAPQPLLLPTETDIIPATSERDDLEAGTSLREVVPLRNMT
REDSLDSVVSDKTTVVAAPGSSSQMPTPTGKGPTGEMFGTKPTEPTANLMDAQPEIAPVP
ALVPVPPPSEDEVAELEEGDVPETTIRLVGAKTESAPKESV
Download sequence
Identical sequences A0A0K6G8G0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]