SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K6GD47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K6GD47
Domain Number 1 Region: 5-65
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.0000000000000262
Family Preprotein translocase SecE subunit 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K6GD47
Sequence length 70
Comment (tr|A0A0K6GD47|A0A0K6GD47_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:CUA76405.1} KW=Complete proteome; Reference proteome OX=456999 OS=Rhizoctonia solani. GN=RSOLAG22IIIB_12254 OC=Agaricomycetes; Cantharellales; Ceratobasidiaceae; Rhizoctonia.
Sequence
MSDKVKEFVEMPQEFAKEGKLFLTRCTKPTQKEYIQICKAVAIGFGIMGFIGYFVKLIHI
PINNILVGGA
Download sequence
Identical sequences A0A0K6GD47

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]