SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K6I005 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K6I005
Domain Number 1 Region: 116-174
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000392
Family SMI1/KNR4-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K6I005
Sequence length 193
Comment (tr|A0A0K6I005|A0A0K6I005_9BURK) Cell wall assembly regulator SMI1 {ECO:0000313|EMBL:CUA96416.1} KW=Complete proteome OX=363952 OS=Comamonas thiooxydans. GN=Ga0061062_105172 OC=Comamonadaceae; Comamonas.
Sequence
MPATMTPDQYLAHLQAVYAAFQLRFHPLPPASEQDLAALAAALGPLDTDLAAFWRLTAGS
STDSTQPLFQRPGFVDALDLLTPSQAMAQALRMEKRAQRMWDLAGPASQDPRLSGRWWHA
GWQPFASFYGDIVLMADHHPGPEGQRGQIIAYVHDPDQIYWIAPSFSAYLQASADSIDDD
REEFLNGPLDEQE
Download sequence
Identical sequences A0A0K6I005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]