SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K6IEB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K6IEB3
Domain Number 1 Region: 152-283
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000209
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K6IEB3
Sequence length 325
Comment (tr|A0A0K6IEB3|A0A0K6IEB3_9BURK) SMI1 / KNR4 family (SUKH-1) {ECO:0000313|EMBL:CUB01469.1} KW=Complete proteome OX=363952 OS=Comamonas thiooxydans. GN=Ga0061062_11471 OC=Comamonadaceae; Comamonas.
Sequence
MKIFKDLPALVQALPELTLSDWVDLPADAAAQLDAPHQSPPAGLLAQPALRFVVRDANEA
PRMGHKPWMPVAVLAQMHWPSPSDAVAWSRFLQAEFGRSQRFVENHDVWDEADLPEPYWQ
PADASLDQRLAHWYQGLQAHAWMDEEPAQARPFSRAELRLCEWRLGCNLPESLRDYLLQL
GVLDWAERLLSPCFDLMAPDADMDAIGPVQVVFPGIADIVEMSAPQQALALKAQLSELVV
FGDYLGNGNLWCFDRRDGSVWYLDHDSSPLLTRMFDDVGDYLDALALMSLCRSHAVAQGQ
DDGDEQAEVLLAKRFGRALIRKWMY
Download sequence
Identical sequences A0A0K6IEB3
WP_045839752.1.23302 WP_045839752.1.32664 WP_045839752.1.85196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]