SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K6J9C6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0K6J9C6
Domain Number - Region: 11-45
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.068
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K6J9C6
Sequence length 48
Comment (tr|A0A0K6J9C6|A0A0K6J9C6_BACCE) Uncharacterized protein {ECO:0000313|EMBL:CUB11990.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=BACERE00183_00038 OC=Bacillus cereus group.
Sequence
MQFKEIDQQFIEKQIEKDLFEDVLNNQENPVEFFYEILDVLQQFENKG
Download sequence
Identical sequences A0A0K6J9C6 A0A1D3RCZ9 A0A1M6RNR6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]