SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K6KGV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K6KGV4
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.97e-16
Family SMI1/KNR4-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K6KGV4
Sequence length 94
Comment (tr|A0A0K6KGV4|A0A0K6KGV4_BACCE) Antitoxin YobK {ECO:0000313|EMBL:CUB26782.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=BN2127_JRS1_08548 OC=Bacillus cereus group.
Sequence
MILGYDSHGAEVVEQTKEYRTFYKLIPGLVVIEYIDEFSYCLDTNKMVDGECPVILWDNH
KGNGYTAAINFLEFLLQRLEKGKEDLNEDEDWED
Download sequence
Identical sequences A0A0K6KGV4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]