SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K8L1I5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K8L1I5
Domain Number 1 Region: 122-209,263-323
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.41e-20
Family SMI1/KNR4-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K8L1I5
Sequence length 515
Comment (tr|A0A0K8L1I5|A0A0K8L1I5_9EURO) Glucan synthesis regulatory protein {ECO:0000313|EMBL:GAO82211.1} KW=Complete proteome; Reference proteome OX=91492 OS=Aspergillus udagawae. GN=AUD_1171 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MTSYDRHASHDSPYRTGRHVPLSQSRHEPLTSIATSAIESRPDLTDTFEDDQPKGSTSSN
SNGWTGSPTGVGSPNRPYSPGLRSLSSQKRRSTERGADGAPEIQMQSFHDGAPPPPPVAH
SWRKIERWLENNYEELHDNLCEGCTQNDINELEHELDCSLPLEVRESLMIHDGQERPGLP
TGVIFGCMLLDCEEIVQEWKNWRTVNEEFLSNSSMMNPPPKATASSSSAAPPPQGPNPLW
RQDLLDRQDSQPPGAVQKAYAHPAWIPLARDWGGNNIAIDLAPGPAGKWGQVIIFGRDYD
CKYVVARSWAAFLAVVADDICSGKVNVDEETNELKLLEFKGQNVEPPYLEILRWRTDQKY
GRRAPRRKAPNGLGLNTNSRPGKESPYGSPTPSEERGRSPHRFPNRGSTQSPKTQFGVSS
PLARVTEEATSPVVTSAEVETPEDAPKGNKKEPETDDLMEVVTPQISGKENQDLTDKNDE
QKSPKAEKVQRRESNQGTTAVSEAEVLGEMKNIAI
Download sequence
Identical sequences A0A0K8L1I5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]